Bump reva deps (#8412)

* bump dependencies

Signed-off-by: Jörn Friedrich Dreyer <jfd@butonic.de>

* bump reva and add config options

Signed-off-by: Jörn Friedrich Dreyer <jfd@butonic.de>

---------

Signed-off-by: Jörn Friedrich Dreyer <jfd@butonic.de>
This commit is contained in:
Jörn Friedrich Dreyer
2024-02-21 10:20:36 +01:00
committed by GitHub
parent c92ebf4b46
commit 5ed57cc09a
490 changed files with 19130 additions and 11163 deletions
+246 -7
View File
@@ -9,17 +9,27 @@ You can access the CPU information by accessing the shared CPU variable of the c
Package home: https://github.com/klauspost/cpuid
[![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2)
[![Build Status][3]][4]
[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master
[4]: https://travis-ci.org/klauspost/cpuid
[![Go](https://github.com/klauspost/cpuid/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/cpuid/actions/workflows/go.yml)
## installing
`go get -u github.com/klauspost/cpuid/v2` using modules.
`go get -u github.com/klauspost/cpuid/v2` using modules.
Drop `v2` for others.
Installing binary:
`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
Or download binaries from release page: https://github.com/klauspost/cpuid/releases
### Homebrew
For macOS/Linux users, you can install via [brew](https://brew.sh/)
```sh
$ brew install cpuid
```
## example
```Go
@@ -77,10 +87,14 @@ We have Streaming SIMD 2 Extensions
The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features.
A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler.
To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc.
This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported.
Note that for some cpu/os combinations some features will not be detected.
`amd64` has rather good support and should work reliably on all platforms.
Note that hypervisors may not pass through all CPU features.
Note that hypervisors may not pass through all CPU features through to the guest OS,
so even if your host supports a feature it may not be visible on guests.
## arm64 feature detection
@@ -253,6 +267,231 @@ Exit Code 0
Exit Code 1
```
## Available flags
### x86 & amd64
| Feature Flag | Description |
|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------|
| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) |
| AESNI | Advanced Encryption Standard New Instructions |
| AMD3DNOW | AMD 3DNOW |
| AMD3DNOWEXT | AMD 3DNowExt |
| AMXBF16 | Tile computational operations on BFLOAT16 numbers |
| AMXINT8 | Tile computational operations on 8-bit integers |
| AMXFP16 | Tile computational operations on FP16 numbers |
| AMXTILE | Tile architecture |
| APX_F | Intel APX |
| AVX | AVX functions |
| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported |
| AVX10_128 | If set indicates that AVX10 128-bit vector support is present |
| AVX10_256 | If set indicates that AVX10 256-bit vector support is present |
| AVX10_512 | If set indicates that AVX10 512-bit vector support is present |
| AVX2 | AVX2 functions |
| AVX512BF16 | AVX-512 BFLOAT16 Instructions |
| AVX512BITALG | AVX-512 Bit Algorithms |
| AVX512BW | AVX-512 Byte and Word Instructions |
| AVX512CD | AVX-512 Conflict Detection Instructions |
| AVX512DQ | AVX-512 Doubleword and Quadword Instructions |
| AVX512ER | AVX-512 Exponential and Reciprocal Instructions |
| AVX512F | AVX-512 Foundation |
| AVX512FP16 | AVX-512 FP16 Instructions |
| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions |
| AVX512PF | AVX-512 Prefetch Instructions |
| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions |
| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 |
| AVX512VL | AVX-512 Vector Length Extensions |
| AVX512VNNI | AVX-512 Vector Neural Network Instructions |
| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q |
| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword |
| AVXIFMA | AVX-IFMA instructions |
| AVXNECONVERT | AVX-NE-CONVERT instructions |
| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one |
| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions |
| AVXVNNIINT8 | AVX-VNNI-INT8 instructions |
| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 |
| BMI1 | Bit Manipulation Instruction Set 1 |
| BMI2 | Bit Manipulation Instruction Set 2 |
| CETIBT | Intel CET Indirect Branch Tracking |
| CETSS | Intel CET Shadow Stack |
| CLDEMOTE | Cache Line Demote |
| CLMUL | Carry-less Multiplication |
| CLZERO | CLZERO instruction supported |
| CMOV | i686 CMOV |
| CMPCCXADD | CMPCCXADD instructions |
| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB |
| CMPXCHG8 | CMPXCHG8 instruction |
| CPBOOST | Core Performance Boost |
| CPPC | AMD: Collaborative Processor Performance Control |
| CX16 | CMPXCHG16B Instruction |
| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ |
| ENQCMD | Enqueue Command |
| ERMS | Enhanced REP MOVSB/STOSB |
| F16C | Half-precision floating-point conversion |
| FLUSH_L1D | Flush L1D cache |
| FMA3 | Intel FMA 3. Does not imply AVX. |
| FMA4 | Bulldozer FMA4 functions |
| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide |
| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide |
| FSRM | Fast Short Rep Mov |
| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 |
| FXSROPT | FXSAVE/FXRSTOR optimizations |
| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. |
| HLE | Hardware Lock Elision |
| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR |
| HTT | Hyperthreading (enabled) |
| HWA | Hardware assert supported. Indicates support for MSRC001_10 |
| HYBRID_CPU | This part has CPUs of more than one type. |
| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors |
| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) |
| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR |
| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) |
| IBRS | AMD: Indirect Branch Restricted Speculation |
| IBRS_PREFERRED | AMD: IBRS is preferred over software solution |
| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection |
| IBS | Instruction Based Sampling (AMD) |
| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) |
| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) |
| IBSFFV | Instruction Based Sampling Feature (AMD) |
| IBSOPCNT | Instruction Based Sampling Feature (AMD) |
| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) |
| IBSOPSAM | Instruction Based Sampling Feature (AMD) |
| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) |
| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) |
| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported |
| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported |
| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse |
| IBS_PREVENTHOST | Disallowing IBS use by the host supported |
| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 |
| IDPRED_CTRL | IPRED_DIS |
| INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
| INVLPGB | NVLPGB and TLBSYNC instruction supported |
| KEYLOCKER | Key locker |
| KEYLOCKERW | Key locker wide |
| LAHF | LAHF/SAHF in long mode |
| LAM | If set, CPU supports Linear Address Masking |
| LBRVIRT | LBR virtualization |
| LZCNT | LZCNT instruction |
| MCAOVERFLOW | MCA overflow recovery support. |
| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. |
| MCOMMIT | MCOMMIT instruction supported |
| MD_CLEAR | VERW clears CPU buffers |
| MMX | standard MMX |
| MMXEXT | SSE integer functions or AMD MMX ext |
| MOVBE | MOVBE instruction (big-endian) |
| MOVDIR64B | Move 64 Bytes as Direct Store |
| MOVDIRI | Move Doubleword as Direct Store |
| MOVSB_ZL | Fast Zero-Length MOVSB |
| MPX | Intel MPX (Memory Protection Extensions) |
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
| MSRIRC | Instruction Retired Counter MSR available |
| MSRLIST | Read/Write List of Model Specific Registers |
| MSR_PAGEFLUSH | Page Flush MSR available |
| NRIPS | Indicates support for NRIP save on VMEXIT |
| NX | NX (No-Execute) bit |
| OSXSAVE | XSAVE enabled by OS |
| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption |
| POPCNT | POPCNT instruction |
| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled |
| PREFETCHI | PREFETCHIT0/1 instructions |
| PSFD | Predictive Store Forward Disable |
| RDPRU | RDPRU instruction supported |
| RDRAND | RDRAND instruction is available |
| RDSEED | RDSEED instruction is available |
| RDTSCP | RDTSCP Instruction |
| RRSBA_CTRL | Restricted RSB Alternate |
| RTM | Restricted Transactional Memory |
| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. |
| SERIALIZE | Serialize Instruction Execution |
| SEV | AMD Secure Encrypted Virtualization supported |
| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host |
| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported |
| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests |
| SEV_ES | AMD SEV Encrypted State supported |
| SEV_RESTRICTED | AMD SEV Restricted Injection supported |
| SEV_SNP | AMD SEV Secure Nested Paging supported |
| SGX | Software Guard Extensions |
| SGXLC | Software Guard Extensions Launch Control |
| SHA | Intel SHA Extensions |
| SME | AMD Secure Memory Encryption supported |
| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced |
| SPEC_CTRL_SSBD | Speculative Store Bypass Disable |
| SRBDS_CTRL | SRBDS mitigation MSR available |
| SSE | SSE functions |
| SSE2 | P4 SSE functions |
| SSE3 | Prescott SSE3 functions |
| SSE4 | Penryn SSE4.1 functions |
| SSE42 | Nehalem SSE4.2 functions |
| SSE4A | AMD Barcelona microarchitecture SSE4a instructions |
| SSSE3 | Conroe SSSE3 functions |
| STIBP | Single Thread Indirect Branch Predictors |
| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On |
| STOSB_SHORT | Fast short STOSB |
| SUCCOR | Software uncorrectable error containment and recovery capability. |
| SVM | AMD Secure Virtual Machine |
| SVMDA | Indicates support for the SVM decode assists. |
| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control |
| SVML | AMD SVM lock. Indicates support for SVM-Lock. |
| SVMNP | AMD SVM nested paging |
| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter |
| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold |
| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. |
| SYSEE | SYSENTER and SYSEXIT instructions |
| TBM | AMD Trailing Bit Manipulation |
| TDX_GUEST | Intel Trust Domain Extensions Guest |
| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations |
| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. |
| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. |
| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 |
| TSXLDTRK | Intel TSX Suspend Load Address Tracking |
| VAES | Vector AES. AVX(512) versions requires additional checks. |
| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. |
| VMPL | AMD VM Permission Levels supported |
| VMSA_REGPROT | AMD VMSA Register Protection supported |
| VMX | Virtual Machine Extensions |
| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. |
| VTE | AMD Virtual Transparent Encryption supported |
| WAITPKG | TPAUSE, UMONITOR, UMWAIT |
| WBNOINVD | Write Back and Do Not Invalidate Cache |
| WRMSRNS | Non-Serializing Write to Model Specific Register |
| X87 | FPU |
| XGETBV1 | Supports XGETBV with ECX = 1 |
| XOP | Bulldozer XOP functions |
| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV |
| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. |
| XSAVEOPT | XSAVEOPT available |
| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS |
# ARM features:
| Feature Flag | Description |
|--------------|------------------------------------------------------------------|
| AESARM | AES instructions |
| ARMCPUID | Some CPU ID registers readable at user-level |
| ASIMD | Advanced SIMD |
| ASIMDDP | SIMD Dot Product |
| ASIMDHP | Advanced SIMD half-precision floating point |
| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) |
| ATOMICS | Large System Extensions (LSE) |
| CRC32 | CRC32/CRC32C instructions |
| DCPOP | Data cache clean to Point of Persistence (DC CVAP) |
| EVTSTRM | Generic timer |
| FCMA | Floatin point complex number addition and multiplication |
| FP | Single-precision and double-precision floating point |
| FPHP | Half-precision floating point |
| GPA | Generic Pointer Authentication |
| JSCVT | Javascript-style double->int convert (FJCVTZS) |
| LRCPC | Weaker release consistency (LDAPR, etc) |
| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) |
| SHA1 | SHA-1 instructions (SHA1C, etc) |
| SHA2 | SHA-2 instructions (SHA256H, etc) |
| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) |
| SHA512 | SHA512 instructions |
| SM3 | SM3 instructions |
| SM4 | SM4 instructions |
| SVE | Scalable Vector Extension |
# license
This code is published under an MIT license. See LICENSE file for more information.
+249 -38
View File
@@ -73,9 +73,15 @@ const (
AMD3DNOW // AMD 3DNOW
AMD3DNOWEXT // AMD 3DNowExt
AMXBF16 // Tile computational operations on BFLOAT16 numbers
AMXFP16 // Tile computational operations on FP16 numbers
AMXINT8 // Tile computational operations on 8-bit integers
AMXTILE // Tile architecture
APX_F // Intel APX
AVX // AVX functions
AVX10 // If set the Intel AVX10 Converged Vector ISA is supported
AVX10_128 // If set indicates that AVX10 128-bit vector support is present
AVX10_256 // If set indicates that AVX10 256-bit vector support is present
AVX10_512 // If set indicates that AVX10 512-bit vector support is present
AVX2 // AVX2 functions
AVX512BF16 // AVX-512 BFLOAT16 Instructions
AVX512BITALG // AVX-512 Bit Algorithms
@@ -93,8 +99,12 @@ const (
AVX512VNNI // AVX-512 Vector Neural Network Instructions
AVX512VP2INTERSECT // AVX-512 Intersect for D/Q
AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword
AVXIFMA // AVX-IFMA instructions
AVXNECONVERT // AVX-NE-CONVERT instructions
AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
AVXVNNIINT8 // AVX-VNNI-INT8 instructions
BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
BMI1 // Bit Manipulation Instruction Set 1
BMI2 // Bit Manipulation Instruction Set 2
CETIBT // Intel CET Indirect Branch Tracking
@@ -103,15 +113,22 @@ const (
CLMUL // Carry-less Multiplication
CLZERO // CLZERO instruction supported
CMOV // i686 CMOV
CMPCCXADD // CMPCCXADD instructions
CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB
CMPXCHG8 // CMPXCHG8 instruction
CPBOOST // Core Performance Boost
CPPC // AMD: Collaborative Processor Performance Control
CX16 // CMPXCHG16B Instruction
EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ
ENQCMD // Enqueue Command
ERMS // Enhanced REP MOVSB/STOSB
F16C // Half-precision floating-point conversion
FLUSH_L1D // Flush L1D cache
FMA3 // Intel FMA 3. Does not imply AVX.
FMA4 // Bulldozer FMA4 functions
FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide
FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide
FSRM // Fast Short Rep Mov
FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9
FXSROPT // FXSAVE/FXRSTOR optimizations
GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage.
@@ -119,8 +136,14 @@ const (
HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR
HTT // Hyperthreading (enabled)
HWA // Hardware assert supported. Indicates support for MSRC001_10
HYBRID_CPU // This part has CPUs of more than one type.
HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors
IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel)
IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR
IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)
IBRS // AMD: Indirect Branch Restricted Speculation
IBRS_PREFERRED // AMD: IBRS is preferred over software solution
IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection
IBS // Instruction Based Sampling (AMD)
IBSBRNTRGT // Instruction Based Sampling Feature (AMD)
IBSFETCHSAM // Instruction Based Sampling Feature (AMD)
@@ -130,36 +153,50 @@ const (
IBSOPSAM // Instruction Based Sampling Feature (AMD)
IBSRDWROPCNT // Instruction Based Sampling Feature (AMD)
IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD)
IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported
IBS_OPDATA4 // AMD: IBS op data 4 MSR supported
IBS_OPFUSE // AMD: Indicates support for IbsOpFuse
IBS_PREVENTHOST // Disallowing IBS use by the host supported
IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4
IDPRED_CTRL // IPRED_DIS
INT_WBINVD // WBINVD/WBNOINVD are interruptible.
INVLPGB // NVLPGB and TLBSYNC instruction supported
KEYLOCKER // Key locker
KEYLOCKERW // Key locker wide
LAHF // LAHF/SAHF in long mode
LAM // If set, CPU supports Linear Address Masking
LBRVIRT // LBR virtualization
LZCNT // LZCNT instruction
MCAOVERFLOW // MCA overflow recovery support.
MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it.
MCOMMIT // MCOMMIT instruction supported
MD_CLEAR // VERW clears CPU buffers
MMX // standard MMX
MMXEXT // SSE integer functions or AMD MMX ext
MOVBE // MOVBE instruction (big-endian)
MOVDIR64B // Move 64 Bytes as Direct Store
MOVDIRI // Move Doubleword as Direct Store
MOVSB_ZL // Fast Zero-Length MOVSB
MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD
MPX // Intel MPX (Memory Protection Extensions)
MSRIRC // Instruction Retired Counter MSR available
MSRLIST // Read/Write List of Model Specific Registers
MSR_PAGEFLUSH // Page Flush MSR available
NRIPS // Indicates support for NRIP save on VMEXIT
NX // NX (No-Execute) bit
OSXSAVE // XSAVE enabled by OS
PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption
POPCNT // POPCNT instruction
PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled
PREFETCHI // PREFETCHIT0/1 instructions
PSFD // Predictive Store Forward Disable
RDPRU // RDPRU instruction supported
RDRAND // RDRAND instruction is available
RDSEED // RDSEED instruction is available
RDTSCP // RDTSCP Instruction
RRSBA_CTRL // Restricted RSB Alternate
RTM // Restricted Transactional Memory
RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort.
SCE // SYSENTER and SYSEXIT instructions
SERIALIZE // Serialize Instruction Execution
SEV // AMD Secure Encrypted Virtualization supported
SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host
@@ -173,6 +210,8 @@ const (
SHA // Intel SHA Extensions
SME // AMD Secure Memory Encryption supported
SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced
SPEC_CTRL_SSBD // Speculative Store Bypass Disable
SRBDS_CTRL // SRBDS mitigation MSR available
SSE // SSE functions
SSE2 // P4 SSE functions
SSE3 // Prescott SSE3 functions
@@ -181,6 +220,7 @@ const (
SSE4A // AMD Barcelona microarchitecture SSE4a instructions
SSSE3 // Conroe SSSE3 functions
STIBP // Single Thread Indirect Branch Predictors
STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On
STOSB_SHORT // Fast short STOSB
SUCCOR // Software uncorrectable error containment and recovery capability.
SVM // AMD Secure Virtual Machine
@@ -190,8 +230,13 @@ const (
SVMNP // AMD SVM nested paging
SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter
SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold
SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
SYSEE // SYSENTER and SYSEXIT instructions
TBM // AMD Trailing Bit Manipulation
TDX_GUEST // Intel Trust Domain Extensions Guest
TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104
TSXLDTRK // Intel TSX Suspend Load Address Tracking
VAES // Vector AES. AVX(512) versions requires additional checks.
@@ -203,6 +248,7 @@ const (
VTE // AMD Virtual Transparent Encryption supported
WAITPKG // TPAUSE, UMONITOR, UMWAIT
WBNOINVD // Write Back and Do Not Invalidate Cache
WRMSRNS // Non-Serializing Write to Model Specific Register
X87 // FPU
XGETBV1 // Supports XGETBV with ECX = 1
XOP // Bulldozer XOP functions
@@ -253,6 +299,7 @@ type CPUInfo struct {
LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable.
Family int // CPU family number
Model int // CPU model number
Stepping int // CPU stepping info
CacheLine int // Cache line size in bytes. Will be 0 if undetectable.
Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed.
BoostFreq int64 // Max clock speed, if known, 0 otherwise
@@ -262,9 +309,10 @@ type CPUInfo struct {
L2 int // L2 Cache (per core or shared). Will be -1 if undetected
L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected
}
SGX SGXSupport
maxFunc uint32
maxExFunc uint32
SGX SGXSupport
AVX10Level uint8
maxFunc uint32
maxExFunc uint32
}
var cpuid func(op uint32) (eax, ebx, ecx, edx uint32)
@@ -355,30 +403,61 @@ func (c CPUInfo) Supports(ids ...FeatureID) bool {
// Has allows for checking a single feature.
// Should be inlined by the compiler.
func (c CPUInfo) Has(id FeatureID) bool {
func (c *CPUInfo) Has(id FeatureID) bool {
return c.featureSet.inSet(id)
}
// AnyOf returns whether the CPU supports one or more of the requested features.
func (c CPUInfo) AnyOf(ids ...FeatureID) bool {
for _, id := range ids {
if c.featureSet.inSet(id) {
return true
}
}
return false
}
// Features contains several features combined for a fast check using
// CpuInfo.HasAll
type Features *flagSet
// CombineFeatures allows to combine several features for a close to constant time lookup.
func CombineFeatures(ids ...FeatureID) Features {
var v flagSet
for _, id := range ids {
v.set(id)
}
return &v
}
func (c *CPUInfo) HasAll(f Features) bool {
return c.featureSet.hasSetP(f)
}
// https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
var level1Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SCE, SSE, SSE2)
var level2Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SCE, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3)
var level3Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SCE, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE)
var level4Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SCE, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL)
var oneOfLevel = CombineFeatures(SYSEE, SYSCALL)
var level1Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2)
var level2Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3)
var level3Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE)
var level4Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL)
// X64Level returns the microarchitecture level detected on the CPU.
// If features are lacking or non x64 mode, 0 is returned.
// See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
func (c CPUInfo) X64Level() int {
if c.featureSet.hasSet(level4Features) {
if !c.featureSet.hasOneOf(oneOfLevel) {
return 0
}
if c.featureSet.hasSetP(level4Features) {
return 4
}
if c.featureSet.hasSet(level3Features) {
if c.featureSet.hasSetP(level3Features) {
return 3
}
if c.featureSet.hasSet(level2Features) {
if c.featureSet.hasSetP(level2Features) {
return 2
}
if c.featureSet.hasSet(level1Features) {
if c.featureSet.hasSetP(level1Features) {
return 1
}
return 0
@@ -542,7 +621,7 @@ const flagMask = flagBits - 1
// flagSet contains detected cpu features and characteristics in an array of flags
type flagSet [(lastID + flagMask) / flagBits]flags
func (s flagSet) inSet(feat FeatureID) bool {
func (s *flagSet) inSet(feat FeatureID) bool {
return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0
}
@@ -572,7 +651,7 @@ func (s *flagSet) or(other flagSet) {
}
// hasSet returns whether all features are present.
func (s flagSet) hasSet(other flagSet) bool {
func (s *flagSet) hasSet(other flagSet) bool {
for i, v := range other[:] {
if s[i]&v != v {
return false
@@ -581,8 +660,28 @@ func (s flagSet) hasSet(other flagSet) bool {
return true
}
// hasSet returns whether all features are present.
func (s *flagSet) hasSetP(other *flagSet) bool {
for i, v := range other[:] {
if s[i]&v != v {
return false
}
}
return true
}
// hasOneOf returns whether one or more features are present.
func (s *flagSet) hasOneOf(other *flagSet) bool {
for i, v := range other[:] {
if s[i]&v != 0 {
return true
}
}
return false
}
// nEnabled will return the number of enabled flags.
func (s flagSet) nEnabled() (n int) {
func (s *flagSet) nEnabled() (n int) {
for _, v := range s[:] {
n += bits.OnesCount64(uint64(v))
}
@@ -677,7 +776,7 @@ func threadsPerCore() int {
if vend == AMD {
// Workaround for AMD returning 0, assume 2 if >= Zen 2
// It will be more correct than not.
fam, _ := familyModel()
fam, _, _ := familyModel()
_, _, _, d := cpuid(1)
if (d&(1<<28)) != 0 && fam >= 23 {
return 2
@@ -715,14 +814,27 @@ func logicalCores() int {
}
}
func familyModel() (int, int) {
func familyModel() (family, model, stepping int) {
if maxFunctionID() < 0x1 {
return 0, 0
return 0, 0, 0
}
eax, _, _, _ := cpuid(1)
family := ((eax >> 8) & 0xf) + ((eax >> 20) & 0xff)
model := ((eax >> 4) & 0xf) + ((eax >> 12) & 0xf0)
return int(family), int(model)
// If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0].
family = int((eax >> 8) & 0xf)
extFam := family == 0x6 // Intel is 0x6, needs extended model.
if family == 0xf {
// Add ExtFamily
family += int((eax >> 20) & 0xff)
extFam = true
}
// If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0].
model = int((eax >> 4) & 0xf)
if extFam {
// Add ExtModel
model += int((eax >> 12) & 0xf0)
}
stepping = int(eax & 0xf)
return family, model, stepping
}
func physicalCores() int {
@@ -857,7 +969,7 @@ func (c *CPUInfo) cacheSize() {
c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024)
// CPUID Fn8000_001D_EAX_x[N:0] Cache Properties
if maxExtendedFunction() < 0x8000001D {
if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) {
return
}
@@ -974,14 +1086,13 @@ func support() flagSet {
if mfi < 0x1 {
return fs
}
family, model := familyModel()
family, model, _ := familyModel()
_, _, c, d := cpuid(1)
fs.setIf((d&(1<<0)) != 0, X87)
fs.setIf((d&(1<<8)) != 0, CMPXCHG8)
fs.setIf((d&(1<<11)) != 0, SCE)
fs.setIf((d&(1<<11)) != 0, SYSEE)
fs.setIf((d&(1<<15)) != 0, CMOV)
fs.setIf((d&(1<<22)) != 0, MMXEXT)
fs.setIf((d&(1<<23)) != 0, MMX)
fs.setIf((d&(1<<24)) != 0, FXSR)
fs.setIf((d&(1<<25)) != 0, FXSROPT)
@@ -989,9 +1100,9 @@ func support() flagSet {
fs.setIf((d&(1<<26)) != 0, SSE2)
fs.setIf((c&1) != 0, SSE3)
fs.setIf((c&(1<<5)) != 0, VMX)
fs.setIf((c&0x00000200) != 0, SSSE3)
fs.setIf((c&0x00080000) != 0, SSE4)
fs.setIf((c&0x00100000) != 0, SSE42)
fs.setIf((c&(1<<9)) != 0, SSSE3)
fs.setIf((c&(1<<19)) != 0, SSE4)
fs.setIf((c&(1<<20)) != 0, SSE42)
fs.setIf((c&(1<<25)) != 0, AESNI)
fs.setIf((c&(1<<1)) != 0, CLMUL)
fs.setIf(c&(1<<22) != 0, MOVBE)
@@ -1062,29 +1173,47 @@ func support() flagSet {
fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
fs.setIf(ecx&(1<<13) != 0, TME)
fs.setIf(ecx&(1<<25) != 0, CLDEMOTE)
fs.setIf(ecx&(1<<23) != 0, KEYLOCKER)
fs.setIf(ecx&(1<<27) != 0, MOVDIRI)
fs.setIf(ecx&(1<<28) != 0, MOVDIR64B)
fs.setIf(ecx&(1<<29) != 0, ENQCMD)
fs.setIf(ecx&(1<<30) != 0, SGXLC)
// CPUID.(EAX=7, ECX=0).EDX
fs.setIf(edx&(1<<4) != 0, FSRM)
fs.setIf(edx&(1<<9) != 0, SRBDS_CTRL)
fs.setIf(edx&(1<<10) != 0, MD_CLEAR)
fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT)
fs.setIf(edx&(1<<14) != 0, SERIALIZE)
fs.setIf(edx&(1<<15) != 0, HYBRID_CPU)
fs.setIf(edx&(1<<16) != 0, TSXLDTRK)
fs.setIf(edx&(1<<18) != 0, PCONFIG)
fs.setIf(edx&(1<<20) != 0, CETIBT)
fs.setIf(edx&(1<<26) != 0, IBPB)
fs.setIf(edx&(1<<27) != 0, STIBP)
fs.setIf(edx&(1<<28) != 0, FLUSH_L1D)
fs.setIf(edx&(1<<29) != 0, IA32_ARCH_CAP)
fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP)
fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD)
// CPUID.(EAX=7, ECX=1)
eax1, _, _, _ := cpuidex(7, 1)
// CPUID.(EAX=7, ECX=1).EAX
eax1, _, _, edx1 := cpuidex(7, 1)
fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
fs.setIf(eax1&(1<<7) != 0, CMPCCXADD)
fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT)
fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT)
fs.setIf(eax1&(1<<22) != 0, HRESET)
fs.setIf(eax1&(1<<23) != 0, AVXIFMA)
fs.setIf(eax1&(1<<26) != 0, LAM)
// CPUID.(EAX=7, ECX=1).EDX
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
fs.setIf(edx1&(1<<19) != 0, AVX10)
fs.setIf(edx1&(1<<21) != 0, APX_F)
// Only detect AVX-512 features if XGETBV is supported
if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
// Check for OS support
@@ -1120,9 +1249,35 @@ func support() flagSet {
fs.setIf(edx&(1<<25) != 0, AMXINT8)
// eax1 = CPUID.(EAX=7, ECX=1).EAX
fs.setIf(eax1&(1<<5) != 0, AVX512BF16)
fs.setIf(eax1&(1<<19) != 0, WRMSRNS)
fs.setIf(eax1&(1<<21) != 0, AMXFP16)
fs.setIf(eax1&(1<<27) != 0, MSRLIST)
}
}
// CPUID.(EAX=7, ECX=2)
_, _, _, edx = cpuidex(7, 2)
fs.setIf(edx&(1<<0) != 0, PSFD)
fs.setIf(edx&(1<<1) != 0, IDPRED_CTRL)
fs.setIf(edx&(1<<2) != 0, RRSBA_CTRL)
fs.setIf(edx&(1<<4) != 0, BHI_CTRL)
fs.setIf(edx&(1<<5) != 0, MCDT_NO)
// Add keylocker features.
if fs.inSet(KEYLOCKER) && mfi >= 0x19 {
_, ebx, _, _ := cpuidex(0x19, 0)
fs.setIf(ebx&5 == 5, KEYLOCKERW) // Bit 0 and 2 (1+4)
}
// Add AVX10 features.
if fs.inSet(AVX10) && mfi >= 0x24 {
_, ebx, _, _ := cpuidex(0x24, 0)
fs.setIf(ebx&(1<<16) != 0, AVX10_128)
fs.setIf(ebx&(1<<17) != 0, AVX10_256)
fs.setIf(ebx&(1<<18) != 0, AVX10_512)
}
}
// Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1)
// EAX
// Bit 00: XSAVEOPT is available.
@@ -1156,20 +1311,24 @@ func support() flagSet {
fs.setIf((c&(1<<2)) != 0, SVM)
fs.setIf((c&(1<<6)) != 0, SSE4A)
fs.setIf((c&(1<<10)) != 0, IBS)
fs.setIf((c&(1<<22)) != 0, TOPEXT)
// EDX
fs.setIf((d&(1<<31)) != 0, AMD3DNOW)
fs.setIf((d&(1<<30)) != 0, AMD3DNOWEXT)
fs.setIf((d&(1<<23)) != 0, MMX)
fs.setIf((d&(1<<22)) != 0, MMXEXT)
fs.setIf(d&(1<<11) != 0, SYSCALL)
fs.setIf(d&(1<<20) != 0, NX)
fs.setIf(d&(1<<22) != 0, MMXEXT)
fs.setIf(d&(1<<23) != 0, MMX)
fs.setIf(d&(1<<24) != 0, FXSR)
fs.setIf(d&(1<<25) != 0, FXSROPT)
fs.setIf(d&(1<<27) != 0, RDTSCP)
fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT)
fs.setIf(d&(1<<31) != 0, AMD3DNOW)
/* XOP and FMA4 use the AVX instruction coding scheme, so they can't be
* used unless the OS has AVX support. */
if fs.inSet(AVX) {
fs.setIf((c&0x00000800) != 0, XOP)
fs.setIf((c&0x00010000) != 0, FMA4)
fs.setIf((c&(1<<11)) != 0, XOP)
fs.setIf((c&(1<<16)) != 0, FMA4)
}
}
@@ -1183,9 +1342,21 @@ func support() flagSet {
if maxExtendedFunction() >= 0x80000008 {
_, b, _, _ := cpuid(0x80000008)
fs.setIf(b&(1<<28) != 0, PSFD)
fs.setIf(b&(1<<27) != 0, CPPC)
fs.setIf(b&(1<<24) != 0, SPEC_CTRL_SSBD)
fs.setIf(b&(1<<23) != 0, PPIN)
fs.setIf(b&(1<<21) != 0, TLB_FLUSH_NESTED)
fs.setIf(b&(1<<20) != 0, EFER_LMSLE_UNS)
fs.setIf(b&(1<<19) != 0, IBRS_PROVIDES_SMP)
fs.setIf(b&(1<<18) != 0, IBRS_PREFERRED)
fs.setIf(b&(1<<17) != 0, STIBP_ALWAYSON)
fs.setIf(b&(1<<15) != 0, STIBP)
fs.setIf(b&(1<<14) != 0, IBRS)
fs.setIf((b&(1<<13)) != 0, INT_WBINVD)
fs.setIf(b&(1<<12) != 0, IBPB)
fs.setIf((b&(1<<9)) != 0, WBNOINVD)
fs.setIf((b&(1<<8)) != 0, MCOMMIT)
fs.setIf((b&(1<<13)) != 0, INT_WBINVD)
fs.setIf((b&(1<<4)) != 0, RDPRU)
fs.setIf((b&(1<<3)) != 0, INVLPGB)
fs.setIf((b&(1<<1)) != 0, MSRIRC)
@@ -1206,6 +1377,13 @@ func support() flagSet {
fs.setIf((edx>>12)&1 == 1, SVMPFT)
}
if maxExtendedFunction() >= 0x8000001a {
eax, _, _, _ := cpuid(0x8000001a)
fs.setIf((eax>>0)&1 == 1, FP128)
fs.setIf((eax>>1)&1 == 1, MOVU)
fs.setIf((eax>>2)&1 == 1, FP256)
}
if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) {
eax, _, _, _ := cpuid(0x8000001b)
fs.setIf((eax>>0)&1 == 1, IBSFFV)
@@ -1216,6 +1394,10 @@ func support() flagSet {
fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT)
fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT)
fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK)
fs.setIf((eax>>8)&1 == 1, IBS_OPFUSE)
fs.setIf((eax>>9)&1 == 1, IBS_FETCH_CTLX)
fs.setIf((eax>>10)&1 == 1, IBS_OPDATA4) // Doc says "Fixed,0. IBS op data 4 MSR supported", but assuming they mean 1.
fs.setIf((eax>>11)&1 == 1, IBS_ZEN4)
}
if maxExtendedFunction() >= 0x8000001f && vend == AMD {
@@ -1236,9 +1418,38 @@ func support() flagSet {
fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
}
if mfi >= 0x20 {
// Microsoft has decided to purposefully hide the information
// of the guest TEE when VMs are being created using Hyper-V.
//
// This leads us to check for the Hyper-V cpuid features
// (0x4000000C), and then for the `ebx` value set.
//
// For Intel TDX, `ebx` is set as `0xbe3`, being 3 the part
// we're mostly interested about,according to:
// https://github.com/torvalds/linux/blob/d2f51b3516dade79269ff45eae2a7668ae711b25/arch/x86/include/asm/hyperv-tlfs.h#L169-L174
_, ebx, _, _ := cpuid(0x4000000C)
fs.setIf(ebx == 0xbe3, TDX_GUEST)
}
if mfi >= 0x21 {
// Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
_, ebx, ecx, edx := cpuid(0x21)
identity := string(valAsString(ebx, edx, ecx))
fs.setIf(identity == "IntelTDX ", TDX_GUEST)
}
return fs
}
func (c *CPUInfo) supportAVX10() uint8 {
if c.maxFunc >= 0x24 && c.featureSet.inSet(AVX10) {
_, ebx, _, _ := cpuidex(0x24, 0)
return uint8(ebx)
}
return 0
}
func valAsString(values ...uint32) []byte {
r := make([]byte, 4*len(values))
for i, v := range values {
+2 -1
View File
@@ -24,13 +24,14 @@ func addInfo(c *CPUInfo, safe bool) {
c.maxExFunc = maxExtendedFunction()
c.BrandName = brandName()
c.CacheLine = cacheLine()
c.Family, c.Model = familyModel()
c.Family, c.Model, c.Stepping = familyModel()
c.featureSet = support()
c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC))
c.ThreadsPerCore = threadsPerCore()
c.LogicalCores = logicalCores()
c.PhysicalCores = physicalCores()
c.VendorID, c.VendorString = vendorID()
c.AVX10Level = c.supportAVX10()
c.cacheSize()
c.frequencies()
}
+210 -164
View File
@@ -13,174 +13,220 @@ func _() {
_ = x[AMD3DNOW-3]
_ = x[AMD3DNOWEXT-4]
_ = x[AMXBF16-5]
_ = x[AMXINT8-6]
_ = x[AMXTILE-7]
_ = x[AVX-8]
_ = x[AVX2-9]
_ = x[AVX512BF16-10]
_ = x[AVX512BITALG-11]
_ = x[AVX512BW-12]
_ = x[AVX512CD-13]
_ = x[AVX512DQ-14]
_ = x[AVX512ER-15]
_ = x[AVX512F-16]
_ = x[AVX512FP16-17]
_ = x[AVX512IFMA-18]
_ = x[AVX512PF-19]
_ = x[AVX512VBMI-20]
_ = x[AVX512VBMI2-21]
_ = x[AVX512VL-22]
_ = x[AVX512VNNI-23]
_ = x[AVX512VP2INTERSECT-24]
_ = x[AVX512VPOPCNTDQ-25]
_ = x[AVXSLOW-26]
_ = x[AVXVNNI-27]
_ = x[BMI1-28]
_ = x[BMI2-29]
_ = x[CETIBT-30]
_ = x[CETSS-31]
_ = x[CLDEMOTE-32]
_ = x[CLMUL-33]
_ = x[CLZERO-34]
_ = x[CMOV-35]
_ = x[CMPSB_SCADBS_SHORT-36]
_ = x[CMPXCHG8-37]
_ = x[CPBOOST-38]
_ = x[CX16-39]
_ = x[ENQCMD-40]
_ = x[ERMS-41]
_ = x[F16C-42]
_ = x[FMA3-43]
_ = x[FMA4-44]
_ = x[FXSR-45]
_ = x[FXSROPT-46]
_ = x[GFNI-47]
_ = x[HLE-48]
_ = x[HRESET-49]
_ = x[HTT-50]
_ = x[HWA-51]
_ = x[HYPERVISOR-52]
_ = x[IBPB-53]
_ = x[IBS-54]
_ = x[IBSBRNTRGT-55]
_ = x[IBSFETCHSAM-56]
_ = x[IBSFFV-57]
_ = x[IBSOPCNT-58]
_ = x[IBSOPCNTEXT-59]
_ = x[IBSOPSAM-60]
_ = x[IBSRDWROPCNT-61]
_ = x[IBSRIPINVALIDCHK-62]
_ = x[IBS_PREVENTHOST-63]
_ = x[INT_WBINVD-64]
_ = x[INVLPGB-65]
_ = x[LAHF-66]
_ = x[LAM-67]
_ = x[LBRVIRT-68]
_ = x[LZCNT-69]
_ = x[MCAOVERFLOW-70]
_ = x[MCOMMIT-71]
_ = x[MMX-72]
_ = x[MMXEXT-73]
_ = x[MOVBE-74]
_ = x[MOVDIR64B-75]
_ = x[MOVDIRI-76]
_ = x[MOVSB_ZL-77]
_ = x[MPX-78]
_ = x[MSRIRC-79]
_ = x[MSR_PAGEFLUSH-80]
_ = x[NRIPS-81]
_ = x[NX-82]
_ = x[OSXSAVE-83]
_ = x[PCONFIG-84]
_ = x[POPCNT-85]
_ = x[RDPRU-86]
_ = x[RDRAND-87]
_ = x[RDSEED-88]
_ = x[RDTSCP-89]
_ = x[RTM-90]
_ = x[RTM_ALWAYS_ABORT-91]
_ = x[SCE-92]
_ = x[SERIALIZE-93]
_ = x[SEV-94]
_ = x[SEV_64BIT-95]
_ = x[SEV_ALTERNATIVE-96]
_ = x[SEV_DEBUGSWAP-97]
_ = x[SEV_ES-98]
_ = x[SEV_RESTRICTED-99]
_ = x[SEV_SNP-100]
_ = x[SGX-101]
_ = x[SGXLC-102]
_ = x[SHA-103]
_ = x[SME-104]
_ = x[SME_COHERENT-105]
_ = x[SSE-106]
_ = x[SSE2-107]
_ = x[SSE3-108]
_ = x[SSE4-109]
_ = x[SSE42-110]
_ = x[SSE4A-111]
_ = x[SSSE3-112]
_ = x[STIBP-113]
_ = x[STOSB_SHORT-114]
_ = x[SUCCOR-115]
_ = x[SVM-116]
_ = x[SVMDA-117]
_ = x[SVMFBASID-118]
_ = x[SVML-119]
_ = x[SVMNP-120]
_ = x[SVMPF-121]
_ = x[SVMPFT-122]
_ = x[TBM-123]
_ = x[TME-124]
_ = x[TSCRATEMSR-125]
_ = x[TSXLDTRK-126]
_ = x[VAES-127]
_ = x[VMCBCLEAN-128]
_ = x[VMPL-129]
_ = x[VMSA_REGPROT-130]
_ = x[VMX-131]
_ = x[VPCLMULQDQ-132]
_ = x[VTE-133]
_ = x[WAITPKG-134]
_ = x[WBNOINVD-135]
_ = x[X87-136]
_ = x[XGETBV1-137]
_ = x[XOP-138]
_ = x[XSAVE-139]
_ = x[XSAVEC-140]
_ = x[XSAVEOPT-141]
_ = x[XSAVES-142]
_ = x[AESARM-143]
_ = x[ARMCPUID-144]
_ = x[ASIMD-145]
_ = x[ASIMDDP-146]
_ = x[ASIMDHP-147]
_ = x[ASIMDRDM-148]
_ = x[ATOMICS-149]
_ = x[CRC32-150]
_ = x[DCPOP-151]
_ = x[EVTSTRM-152]
_ = x[FCMA-153]
_ = x[FP-154]
_ = x[FPHP-155]
_ = x[GPA-156]
_ = x[JSCVT-157]
_ = x[LRCPC-158]
_ = x[PMULL-159]
_ = x[SHA1-160]
_ = x[SHA2-161]
_ = x[SHA3-162]
_ = x[SHA512-163]
_ = x[SM3-164]
_ = x[SM4-165]
_ = x[SVE-166]
_ = x[lastID-167]
_ = x[AMXFP16-6]
_ = x[AMXINT8-7]
_ = x[AMXTILE-8]
_ = x[APX_F-9]
_ = x[AVX-10]
_ = x[AVX10-11]
_ = x[AVX10_128-12]
_ = x[AVX10_256-13]
_ = x[AVX10_512-14]
_ = x[AVX2-15]
_ = x[AVX512BF16-16]
_ = x[AVX512BITALG-17]
_ = x[AVX512BW-18]
_ = x[AVX512CD-19]
_ = x[AVX512DQ-20]
_ = x[AVX512ER-21]
_ = x[AVX512F-22]
_ = x[AVX512FP16-23]
_ = x[AVX512IFMA-24]
_ = x[AVX512PF-25]
_ = x[AVX512VBMI-26]
_ = x[AVX512VBMI2-27]
_ = x[AVX512VL-28]
_ = x[AVX512VNNI-29]
_ = x[AVX512VP2INTERSECT-30]
_ = x[AVX512VPOPCNTDQ-31]
_ = x[AVXIFMA-32]
_ = x[AVXNECONVERT-33]
_ = x[AVXSLOW-34]
_ = x[AVXVNNI-35]
_ = x[AVXVNNIINT8-36]
_ = x[BHI_CTRL-37]
_ = x[BMI1-38]
_ = x[BMI2-39]
_ = x[CETIBT-40]
_ = x[CETSS-41]
_ = x[CLDEMOTE-42]
_ = x[CLMUL-43]
_ = x[CLZERO-44]
_ = x[CMOV-45]
_ = x[CMPCCXADD-46]
_ = x[CMPSB_SCADBS_SHORT-47]
_ = x[CMPXCHG8-48]
_ = x[CPBOOST-49]
_ = x[CPPC-50]
_ = x[CX16-51]
_ = x[EFER_LMSLE_UNS-52]
_ = x[ENQCMD-53]
_ = x[ERMS-54]
_ = x[F16C-55]
_ = x[FLUSH_L1D-56]
_ = x[FMA3-57]
_ = x[FMA4-58]
_ = x[FP128-59]
_ = x[FP256-60]
_ = x[FSRM-61]
_ = x[FXSR-62]
_ = x[FXSROPT-63]
_ = x[GFNI-64]
_ = x[HLE-65]
_ = x[HRESET-66]
_ = x[HTT-67]
_ = x[HWA-68]
_ = x[HYBRID_CPU-69]
_ = x[HYPERVISOR-70]
_ = x[IA32_ARCH_CAP-71]
_ = x[IA32_CORE_CAP-72]
_ = x[IBPB-73]
_ = x[IBRS-74]
_ = x[IBRS_PREFERRED-75]
_ = x[IBRS_PROVIDES_SMP-76]
_ = x[IBS-77]
_ = x[IBSBRNTRGT-78]
_ = x[IBSFETCHSAM-79]
_ = x[IBSFFV-80]
_ = x[IBSOPCNT-81]
_ = x[IBSOPCNTEXT-82]
_ = x[IBSOPSAM-83]
_ = x[IBSRDWROPCNT-84]
_ = x[IBSRIPINVALIDCHK-85]
_ = x[IBS_FETCH_CTLX-86]
_ = x[IBS_OPDATA4-87]
_ = x[IBS_OPFUSE-88]
_ = x[IBS_PREVENTHOST-89]
_ = x[IBS_ZEN4-90]
_ = x[IDPRED_CTRL-91]
_ = x[INT_WBINVD-92]
_ = x[INVLPGB-93]
_ = x[KEYLOCKER-94]
_ = x[KEYLOCKERW-95]
_ = x[LAHF-96]
_ = x[LAM-97]
_ = x[LBRVIRT-98]
_ = x[LZCNT-99]
_ = x[MCAOVERFLOW-100]
_ = x[MCDT_NO-101]
_ = x[MCOMMIT-102]
_ = x[MD_CLEAR-103]
_ = x[MMX-104]
_ = x[MMXEXT-105]
_ = x[MOVBE-106]
_ = x[MOVDIR64B-107]
_ = x[MOVDIRI-108]
_ = x[MOVSB_ZL-109]
_ = x[MOVU-110]
_ = x[MPX-111]
_ = x[MSRIRC-112]
_ = x[MSRLIST-113]
_ = x[MSR_PAGEFLUSH-114]
_ = x[NRIPS-115]
_ = x[NX-116]
_ = x[OSXSAVE-117]
_ = x[PCONFIG-118]
_ = x[POPCNT-119]
_ = x[PPIN-120]
_ = x[PREFETCHI-121]
_ = x[PSFD-122]
_ = x[RDPRU-123]
_ = x[RDRAND-124]
_ = x[RDSEED-125]
_ = x[RDTSCP-126]
_ = x[RRSBA_CTRL-127]
_ = x[RTM-128]
_ = x[RTM_ALWAYS_ABORT-129]
_ = x[SERIALIZE-130]
_ = x[SEV-131]
_ = x[SEV_64BIT-132]
_ = x[SEV_ALTERNATIVE-133]
_ = x[SEV_DEBUGSWAP-134]
_ = x[SEV_ES-135]
_ = x[SEV_RESTRICTED-136]
_ = x[SEV_SNP-137]
_ = x[SGX-138]
_ = x[SGXLC-139]
_ = x[SHA-140]
_ = x[SME-141]
_ = x[SME_COHERENT-142]
_ = x[SPEC_CTRL_SSBD-143]
_ = x[SRBDS_CTRL-144]
_ = x[SSE-145]
_ = x[SSE2-146]
_ = x[SSE3-147]
_ = x[SSE4-148]
_ = x[SSE42-149]
_ = x[SSE4A-150]
_ = x[SSSE3-151]
_ = x[STIBP-152]
_ = x[STIBP_ALWAYSON-153]
_ = x[STOSB_SHORT-154]
_ = x[SUCCOR-155]
_ = x[SVM-156]
_ = x[SVMDA-157]
_ = x[SVMFBASID-158]
_ = x[SVML-159]
_ = x[SVMNP-160]
_ = x[SVMPF-161]
_ = x[SVMPFT-162]
_ = x[SYSCALL-163]
_ = x[SYSEE-164]
_ = x[TBM-165]
_ = x[TDX_GUEST-166]
_ = x[TLB_FLUSH_NESTED-167]
_ = x[TME-168]
_ = x[TOPEXT-169]
_ = x[TSCRATEMSR-170]
_ = x[TSXLDTRK-171]
_ = x[VAES-172]
_ = x[VMCBCLEAN-173]
_ = x[VMPL-174]
_ = x[VMSA_REGPROT-175]
_ = x[VMX-176]
_ = x[VPCLMULQDQ-177]
_ = x[VTE-178]
_ = x[WAITPKG-179]
_ = x[WBNOINVD-180]
_ = x[WRMSRNS-181]
_ = x[X87-182]
_ = x[XGETBV1-183]
_ = x[XOP-184]
_ = x[XSAVE-185]
_ = x[XSAVEC-186]
_ = x[XSAVEOPT-187]
_ = x[XSAVES-188]
_ = x[AESARM-189]
_ = x[ARMCPUID-190]
_ = x[ASIMD-191]
_ = x[ASIMDDP-192]
_ = x[ASIMDHP-193]
_ = x[ASIMDRDM-194]
_ = x[ATOMICS-195]
_ = x[CRC32-196]
_ = x[DCPOP-197]
_ = x[EVTSTRM-198]
_ = x[FCMA-199]
_ = x[FP-200]
_ = x[FPHP-201]
_ = x[GPA-202]
_ = x[JSCVT-203]
_ = x[LRCPC-204]
_ = x[PMULL-205]
_ = x[SHA1-206]
_ = x[SHA2-207]
_ = x[SHA3-208]
_ = x[SHA512-209]
_ = x[SM3-210]
_ = x[SM4-211]
_ = x[SVE-212]
_ = x[lastID-213]
_ = x[firstID-0]
}
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWAVXVNNIBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCX16ENQCMDERMSF16CFMA3FMA4FXSRFXSROPTGFNIHLEHRESETHTTHWAHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_PREVENTHOSTINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCOMMITMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMPXMSRIRCMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSCESERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTTBMTMETSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 58, 62, 72, 84, 92, 100, 108, 116, 123, 133, 143, 151, 161, 172, 180, 190, 208, 223, 230, 237, 241, 245, 251, 256, 264, 269, 275, 279, 297, 305, 312, 316, 322, 326, 330, 334, 338, 342, 349, 353, 356, 362, 365, 368, 378, 382, 385, 395, 406, 412, 420, 431, 439, 451, 467, 482, 492, 499, 503, 506, 513, 518, 529, 536, 539, 545, 550, 559, 566, 574, 577, 583, 596, 601, 603, 610, 617, 623, 628, 634, 640, 646, 649, 665, 668, 677, 680, 689, 704, 717, 723, 737, 744, 747, 752, 755, 758, 770, 773, 777, 781, 785, 790, 795, 800, 805, 816, 822, 825, 830, 839, 843, 848, 853, 859, 862, 865, 875, 883, 887, 896, 900, 912, 915, 925, 928, 935, 943, 946, 953, 956, 961, 967, 975, 981, 987, 995, 1000, 1007, 1014, 1022, 1029, 1034, 1039, 1046, 1050, 1052, 1056, 1059, 1064, 1069, 1074, 1078, 1082, 1086, 1092, 1095, 1098, 1101, 1107}
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 554, 568, 585, 588, 598, 609, 615, 623, 634, 642, 654, 670, 684, 695, 705, 720, 728, 739, 749, 756, 765, 775, 779, 782, 789, 794, 805, 812, 819, 827, 830, 836, 841, 850, 857, 865, 869, 872, 878, 885, 898, 903, 905, 912, 919, 925, 929, 938, 942, 947, 953, 959, 965, 975, 978, 994, 1003, 1006, 1015, 1030, 1043, 1049, 1063, 1070, 1073, 1078, 1081, 1084, 1096, 1110, 1120, 1123, 1127, 1131, 1135, 1140, 1145, 1150, 1155, 1169, 1180, 1186, 1189, 1194, 1203, 1207, 1212, 1217, 1223, 1230, 1235, 1238, 1247, 1263, 1266, 1272, 1282, 1290, 1294, 1303, 1307, 1319, 1322, 1332, 1335, 1342, 1350, 1357, 1360, 1367, 1370, 1375, 1381, 1389, 1395, 1401, 1409, 1414, 1421, 1428, 1436, 1443, 1448, 1453, 1460, 1464, 1466, 1470, 1473, 1478, 1483, 1488, 1492, 1496, 1500, 1506, 1509, 1512, 1515, 1521}
func (i FeatureID) String() string {
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
+1 -1
View File
@@ -83,7 +83,7 @@ func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
c.Model = sysctlGetInt(0, "machdep.cpu.model")
c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize")
c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize")
c.Cache.L1D = sysctlGetInt64(-1, "hw.l1icachesize")
c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize")
c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize")
c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize")